123113-ML490
AIP (AH Receptor-interacting Protein, Aryl-hydrocarbon Receptor-interacting Protein, HBV X-associated Protein 2, XAP-2, Immunophilin Homolog ARA9, XAP2) (MaxLight 490)
Größe
£914.00
- SKU:
- 123113-ML490
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa156-250 from AIP (NP_003968) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3D3
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Weitere Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. Ah receptor-associated protein (AIP) is also known as ARA9 and XAP2. This protein displays structural similarity to the glucocorticoid receptor-associated immunophilin FKBP52. Although they share significant homology, they have distinct cellular roles and biochemical properties. AIP is known to affect the potency and efficacy of AHR agonists in the yeast Saccharomyces cerevisiae as well as having functional consequence on AHR signal transduction. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KVESPGTYQQDPWAMTDEEKAKAVPLIHQEGNRLYREGHVKEAAAKYYDAIACLKNLQMKEQPGSPEWIQLDKQITPLLLNYCQCKLVVEEYYE Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice