AIFM2 (Apoptosis-inducing Factor 2, Apoptosis-inducing Factor Homologous Mitochondrion-associated Inducer of Death, Apoptosis-inducing Factor-like Mitochondrion-associated Inducer of Death, p53-responsive Gene 3 Protein, AMID, PRG3, DKFZp686L1298, FLJ14497, RP11-367H5.2) (Biotin)

Größe

£934.00

SKU:: 123109-BIOTIN
Anwendung:: WB
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Full length recombinant protein corresponding to aa1-373 of human AIFM2.
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Weitere Details:: The p53 tumor suppressor protein induces cell cycle arrest or apoptosis in response to cellular stresses. PRG3 (p53-responsive gene 3), is induced specifically under p53-dependent apoptotic conditions in human colon cancer cells. PRG3 has significant homology to bacterial oxidoreductases and the apoptosis-inducing factor, AIF. Unlike AIF, PRG3 localizes in the cytoplasm and its ectopic expression induces apoptosis. The PRG3 gene is thus a novel p53 target gene in a p53-dependent apoptosis pathway. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MGSQVSVESGALHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVETGFAKKTFISYSVTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHLILATGSTGPFPGKFNEVSSQQAAIQAYEDMVRQVQRSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYLAGLHANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLFVSTSWKTMRQSPP Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Versandbedingungen:: Blue Ice