123083-ML490
AHCYL1 (Putative Adenosylhomocysteinase 2, AdoHcyase 2, DC-expressed AHCY-like Molecule, S-adenosyl-L-homocysteine Hydrolase 2, S-adenosylhomocysteine Hydrolase-like Protein 1, DCAL, XPVKONA) (MaxLight 490)
Größe
£914.00
- SKU:
- 123083-ML490
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa1-101 from human AHCYL1 (NP_006612) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 5D6
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Weitere Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. S-adenosyl-L-homocysteine + H2O = L-homocysteine + adenosine. AHCY deficiency is one of the causes of hypermethioninemia, a rare disease affecting brain development and muscle strength. Down-regulation of AHCY is also associated with certain forms of cancer, Huntington's disease and Wilson's disease. Applications: Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MSMPDAMPLPGVGEELKQAKEIEDAEKYSFMATVTKAPKKQIQFADDMQEFTKFPTKTGRRSLSRSISQSSTDSYSSAASYTDSSDDEVSPREKQQTNSKG Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice