AGR3 (BCMP11, Anterior Gradient Protein 3 Homolog, Breast Cancer Membrane Protein 11)

Größe

£760.00

SKU:: 123072
Anwendung:: WB
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Full length human AGR3, aa1-166 (NP_789783.1).
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: AGR3 (Anterior Gradient 3) protein, also known as AG3 (hAG3, HAG3 in human), or BCMP11, is a secreted cytoplasmic protein which is involved in metastasis induction and p53 tumor supressor inhibition. It may serve as molecular marker and potential therapeutic target for hormone-responsive breast tumors. Its Xenopus homolog is associated with anteroposterior fate determination during early development. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MMLHSALGLCLLLVTVSSNLAIAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFYAQKSKKPLMVIHHLEDCQYSQALKKVFAQNEEIQEMAQNKFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADIAGRYSNRLYTYEPRDLPLLIENMKKALRLIQSEL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.