AGPAT6 (Glycerol-3-phosphate Acyltransferase 4, GPAT4, 1-acylglycerol-3-phosphate O-acyltransferase 6, 1-AGP Acyltransferase 6, 1-AGPAT 6, Acyl-CoA:glycerol-3-phosphate Acyltransferase 4, Lysophosphatidic Acid Acyltransferase zeta, LPAAT-zeta, GPAT4, UNQ551/PRO1108, DKFZp586M1819)

Größe

£685.00

SKU:: 123070
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa39-138 from human AGPAT6 (NP_848934) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4C12
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Lysophosphatidic acid acyltransferases (EC 2.3.1.51) catalyze the conversion of lysophosphatidic acid (LPA) to phosphatidic acid (PA). LPA and PA are involved in signal transduction and lipid biosynthesis. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SFGIRKLYMKSLLKIFAWATLRMERGAKEKNHQLYKPYTNGIIAKDPTSLEEEIKEIRRSGSSKALDNTPEFELSDIFYFCRKGMETIMDDEVTKRFSA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.