123070-PE

AGPAT6 (Glycerol-3-phosphate Acyltransferase 4, GPAT4, 1-acylglycerol-3-phosphate O-acyltransferase 6, 1-AGP Acyltransferase 6, 1-AGPAT 6, Acyl-CoA:glycerol-3-phosphate Acyltransferase 4, Lysophosphatidic Acid Acyltransferase zeta, LPAAT-zeta, GPAT4, UNQ551/PRO1108, DKFZp586M1819) (PE)

Größe

£914.00

SKU:: 123070-PE
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa39-138 from human AGPAT6 (NP_848934) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4C12
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Weitere Details:: Lysophosphatidic acid acyltransferases (EC 2.3.1.51) catalyze the conversion of lysophosphatidic acid (LPA) to phosphatidic acid (PA). LPA and PA are involved in signal transduction and lipid biosynthesis. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SFGIRKLYMKSLLKIFAWATLRMERGAKEKNHQLYKPYTNGIIAKDPTSLEEEIKEIRRSGSSKALDNTPEFELSDIFYFCRKGMETIMDDEVTKRFSA Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.