123061
AGP1 (Alpha-1-acid Glycoprotein 1, AGP 1, Orosomucoid-1, OMD 1, ORM1)
Größe
£685.00
- SKU:
- 123061
- Anwendung:
- WB
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length human ORM1, aa1-201 (NP_000598.1).
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- a1-Acid Glycoprotein (AGP; also OMD/Orosomucoid) is a 40-46kD member of the immunocalin subfamily, lipocalin family of molecules. In mouse, circulating AGP is principally the product of hepatocytes that originates from multiple related genes (AGP-1, -2 and -3 in Mus musculus). Circulating AGP-1 and -2 are both 189aa in length, the principal sources of protein, and show 83% aa identity; AGP-3 contributes little to the AGP pool. In mouse blood, AGP is normally 200-400ug/ml. In response to inflammatory mediators (IL-6; IL-1), its concentration will rise 2-10 fold. More importantly, a complex glycosylation pattern will also change, transitioning from modestly branched to highly branched oligosaccharides. This change is reflected in its bioactivity, which has been shown to be a function of carbohydrate branching. AGP is generally considered to be a suppressor of inflammation. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDQITGKWFYIASAFRNEEYNKSVQEIQATFFYFTPNKTEDTIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFAHLLILRDTKTYMLAFDVNDEKNWGLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDWKKDKCEPLEKQHEKERKQEEGES Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice