ADIPOR1 (Adiponectin Receptor Protein 1, Progestin and adipoQ Receptor Family Member I, CGI-45, PAQR1, TESBP1A, CGI45, FLJ25385, FLJ42464)

Größe

£685.00

SKU:: 123019
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa72-136 from human ADIPOR1 (NP_057083) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2C8
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: The adiponectin receptors, ADIPOR1 and ADIPOR2, serve as receptors for globular and full-length adiponectin and mediate increased AMPK and PPAR-alpha ligand activities, as well as fatty acid oxidation and glucose uptake by adiponectin. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: QAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.