ADAMTS2 (A Disintegrin and Metalloproteinase with Thrombospondin Motifs 2, ADAM-TS 2, ADAM-TS2, ADAMTS-2, Procollagen I N-proteinase, PC I-NP, Procollagen I/II Amino Propeptide-processing Enzyme, Procollagen N-endopeptidase, pNPI, PCINP, PCPNI)

Größe

£685.00

SKU:: 122982
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa1112-1210 from ADAMTS2 (NM_014244, NP_055059) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 7G3
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Cleaves the propeptides of type I and II collagen prior to fibril assembly. Does not act on type III collagen. May also play a role in development that is independent of its role in collagen biosynthesis. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KHNDIDVFMPTLPVPTVAMEVRPSPSTPLEVPLNASSTNATEDHPETNAVDEPYKIHGLEDEVQPPNLIPRRPSPYEKTRNQRIQELIDEMRKKEMLGK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.