122980
ADAMTS17 (A Disintegrin and Metalloproteinase with Thrombospondin Motifs 17, ADAM-TS 17, ADAM-TS17, ADAMTS-17, FLJ16363, FLJ32769)
Größe
£685.00
- SKU:
- 122980
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa543-651 from human ADAMTS17 (NP_620688) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3B7
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- ADAMTS17 is a Metallopeptidase M12B type protease. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 1.2ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: DGDWSPWGAWSMCSRTCGTGARFRQRKCDNPPPGPGGTHCPGASVEHAVCENLPCPKGLPSFRDQQCQAHDRLSPKKKGLLTAVVVDDKPCELYCSPLGKESPLLVAD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice