122980-BIOTIN

ADAMTS17 (A Disintegrin and Metalloproteinase with Thrombospondin Motifs 17, ADAM-TS 17, ADAM-TS17, ADAMTS-17, FLJ16363, FLJ32769) (Biotin)

Größe

£927.00

SKU:: 122980-BIOTIN
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa543-651 from human ADAMTS17 (NP_620688) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3B7
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Weitere Details:: ADAMTS17 is a Metallopeptidase M12B type protease. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 1.2ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: DGDWSPWGAWSMCSRTCGTGARFRQRKCDNPPPGPGGTHCPGASVEHAVCENLPCPKGLPSFRDQQCQAHDRLSPKKKGLLTAVVVDDKPCELYCSPLGKESPLLVAD Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.