ADAM29 (Disintegrin and Metalloproteinase Domain-containing Protein 29, ADAM 29, Cancer/Testis Antigen 73, CT73)

Größe

£685.00

SKU:: 122974
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa339-399 from human ADAM29 (NP_055084) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3A6
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: May be involved in spermatogenesis and fertilization. Seems to be a non catalytic metalloprotease-like protein. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GMNHDEDTCRCSQPRCIMHEGNPPITKFSNCSYGDFWEYTVERTKCLLETVHTKDIFNVK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.