122966-PE
ADAM 17 (Disintegrin and Metalloproteinase Domain-containing Protein 17, Snake Venom-like Protease, TNF-alpha Convertase, TNF-alpha-converting Enzyme, CD156b, CSVP, TACE, ADAM17, MGC71942) (PE)
Größe
£914.00
- SKU:
- 122966-PE
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa215-315 from human ADAM17 (NP_003174) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1F6
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
- Weitere Details:
- Membrane-bound form of TNF-a is cleaved by a convertase to generate a secreted 17kD mature protein. TNF-a converting enzyme, TACE, is a membrane bound metalloprotease-disintegrin. It also processes other cell surface proteins, including TNF receptor, TGFa, and alpha cleavage of amyloid protein precursor. Applications: Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: RADPDPMKNTCKLLVVADHRFYRYMGRGEESTTTNYLIELIDRVDDIYRNTSWDNAGFKGYGIQIEQIRILKSPQEVKPGEKHYNMAKSYPNEEKDAWDV Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice