122930-BIOTIN

ACTN1 (Alpha-actinin-1, Alpha-actinin Cytoskeletal Isoform, Non-muscle alpha-actinin-1, F-actin Cross-linking Protein) (Biotin)

Größe

£927.00

SKU:: 122930-BIOTIN
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa543-639 from human ACTN1 (NP_001093) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3F1
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Weitere Details:: ACTN1 is a F-actin cross-linking protein which is thought to anchor actin to a variety of intracellular structures. This is a bundling protein. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: EIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEINGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQA Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.