122908-PE
ACSL5 (Long-chain-fatty-acid-CoA Ligase 5, Long-chain acyl-CoA Synthetase 5, LACS 5, ACS5, FACL5, UNQ633/PRO1250) (PE)
Größe
£914.00
- SKU:
- 122908-PE
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa91-187, from human ACSL5 (NP_057318, 51703) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 5H8
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
- Weitere Details:
- ACSL5 is an isozyme of the long chain fatty acid coenzyme A ligase family. All isozymes of this family convert free long chain fatty acids into fatty acyl CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. ACSL5 is highly expressed in uterus and spleen, and in trace amounts in normal brain, but has markedly increased levels in malignant gliomas. This gene functions in mediating fatty acid induced glioma cell growth. Three transcript variants encoding two different isoforms have been found. Applications: Suitable for use in FLISA, Western Blot, Immunoprecipitation and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: PQPVLPLLDLNNQSVGIEGGARKGVSQKNNDLTSCCFSDAKTMYEVFQRGLAVSDNGPCLGYRKPNQPYRWLSYKQVSDRAEYLGSCLLHKGYKSS Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice