ACSL1 (Acyl-CoA Synthetase Long-chain Family Member 1, Acyl-CoA Synthetase 1, ACS1, FACL1, FACL2, LACS, Long-chain-fatty-acid-CoA Ligase 1, Long-chain Fatty Acid-CoA Ligase 2, Long-chain Acyl-CoA Synthetase 1, LACS 1, LACS1, Long-chain Acyl-CoA Synthetase 2, LACS 2, LACS2, Palmitoyl-CoA Ligase 1, Palmitoyl-CoA Ligase 2)

Größe

£685.00

SKU:: 122903
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa48-145 from human ACSL1 (NP_001986) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3G4
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Mammalian long-chain acyl-CoA synthetase (ACSL) catalyzes the ligation of the fatty acid to CoA to form fatty acyl-CoA in a two-step reaction. Five isoforms of ACSL have been identified. These isoforms have different substrate preferences and subcellular localizations. Overexpression of ACSL1 results in changes of fatty acid metabolism in rat primary hepatocytes. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PKPLKPPCDLSMQSVEVAGSGGARRSALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSYKQVAELSECIGSALIQKGFKTA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.