122903-APC
ACSL1 (Acyl-CoA Synthetase Long-chain Family Member 1, Acyl-CoA Synthetase 1, ACS1, FACL1, FACL2, LACS, Long-chain-fatty-acid-CoA Ligase 1, Long-chain Fatty Acid-CoA Ligase 2, Long-chain Acyl-CoA Synthetase 1, LACS 1, LACS1, Long-chain Acyl-CoA Synthetase 2, LACS 2, LACS2, Palmitoyl-CoA Ligase 1, Palmitoyl-CoA Ligase 2) (APC)
Größe
£927.00
- SKU:
- 122903-APC
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa48-145 from human ACSL1 (NP_001986) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3G4
- Format:
- Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
- Weitere Details:
- Mammalian long-chain acyl-CoA synthetase (ACSL) catalyzes the ligation of the fatty acid to CoA to form fatty acyl-CoA in a two-step reaction. Five isoforms of ACSL have been identified. These isoforms have different substrate preferences and subcellular localizations. Overexpression of ACSL1 results in changes of fatty acid metabolism in rat primary hepatocytes. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PKPLKPPCDLSMQSVEVAGSGGARRSALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSYKQVAELSECIGSALIQKGFKTA Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice