122884-BIOTIN
ACOT8 (ACTEIII, PTE1, PTE2, Acyl-coenzyme A Thioesterase 8, Acyl-CoA Thioesterase 8, Choloyl-coenzyme A Thioesterase, HIV-Nef-associated Acyl-CoA Thioesterase, PTE-2, Peroxisomal Acyl-coenzyme A Thioester Hydrolase 1, Peroxisomal Long-chain Acyl-CoA Thioesterase 1, Thioesterase II) (Biotin)
Größe
£927.00
- SKU:
- 122884-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa108-215 from ACOT8 (NP_005460) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3F1
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- Acyl-CoA thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH. It may mediate Nef-induced down-regulation of CD4. It may be involved in the metabolic regulation of peroxisome proliferation. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SVRSVKAVQHGKPIFICQASFQQAQPSPMQHQFSMPTVPPPEELLDCETLIDQYLRDPNLQKRYPLALNRIAAQEVPIEIKPVNPSPLSQLQRMEPKQMFWVRARGYI Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice