122856-BIOTIN
ACAP2 (Arf-GAP with Coiled-coil, ANK Repeat and PH Domain-containing Protein 2, Centaurin-beta-2, Cnt-b2, CENTB2, KIAA0041) (Biotin)
Größe
£927.00
- SKU:
- 122856-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa473-582 from CENTB2 (NP_036419) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 4G3
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- Centaurin beta 1 and Centaurin beta 2 are recruited to platelet-derived growth factor-induced dorsal membrane ruffles in NIH 3T3 mouse fibroblasts, and overexpression inhibited ruffle formation. In vitro, Centaurin beta 1 and Centaurin beta 2 preferred ARF6 as substrate rather than ARF1 or ARF5, and the GAP activity of both Centaurins was dependent upon phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2). The isolated PH domain of mouse Centaurin beta 2 exhibits moderate affinity for PtdIns(3,5)P2, but it does not bind any other phosphoinositides tested, including PtdIns(4,5)P2. Mutation of a highly conserved arginine in both Centaurins result in lack of ARF-GAP activity. Overexpression in HeLa cells of either Centaurin blocks the formation of ARF6-dependent protrusions. Both Centaurins are also recruited to peripheral, tubular membranes, where activation of ARF6 occurs and allows membrane recycling back to the plasma membrane. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: DVINRVYEANVEKMGIKKPQPGQRQEKEAYIRAKYVERKFVDKYSISLSPPEQQKKFVSKSSEEKRLSISKFGPGDQVRASAQSSVRSNDSGIQQSSDDGRESLPSTVS* Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice