ACAA2 (Acetyl Coenzyme A Acyltransferase 2, Acetyl CoA Acyltransferase 2, 3-ketoacyl CoA Thiolase Mitochondrial, Beta Ketothiolase, DSAEC, Mitochondrial 3-oxoacyl Coenzyme A Thiolase, Mitochondrial 3-oxoacyl-CoA Thiolase, T1)

Größe

£685.00

SKU:: 122841
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa151-260 from ACAA2 (NP_006102) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 5C4
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: The encoded protein catalyzes the last step of the mitochondrial fatty acid beta-oxidation spiral. Unlike most mitochondrial matrix proteins, it contains a non-cleavable amino-terminal targeting signal. [provided by RefSeq] Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 40ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: SLTDQHVQLPMAMTAENLTVKHKISREECDKYALQSQQRWKAANDAGYFNDEMAPIEVKTKKGKQTMQVDEHARPQTTLEQLQKLPPVFKKDGTVTAGNASGVADGAGAV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.