122841-APC
ACAA2 (Acetyl Coenzyme A Acyltransferase 2, Acetyl CoA Acyltransferase 2, 3-ketoacyl CoA Thiolase Mitochondrial, Beta Ketothiolase, DSAEC, Mitochondrial 3-oxoacyl Coenzyme A Thiolase, Mitochondrial 3-oxoacyl-CoA Thiolase, T1) (APC)
Größe
£927.00
- SKU:
- 122841-APC
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa151-260 from ACAA2 (NP_006102) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 5C4
- Format:
- Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
- Weitere Details:
- The encoded protein catalyzes the last step of the mitochondrial fatty acid beta-oxidation spiral. Unlike most mitochondrial matrix proteins, it contains a non-cleavable amino-terminal targeting signal. [provided by RefSeq] Applications: Suitable for use in Immunofluorescence, FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 40ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: SLTDQHVQLPMAMTAENLTVKHKISREECDKYALQSQQRWKAANDAGYFNDEMAPIEVKTKKGKQTMQVDEHARPQTTLEQLQKLPPVFKKDGTVTAGNASGVADGAGAV Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice