122831-HRP

ABLIM1 (Actin-binding LIM Protein 1, abLIM-1, Actin-binding LIM Protein Family Member 1, Actin-binding Double Zinc Finger Protein, LIMAB1, Limatin, ABLIM, KIAA0059, DKFZp781D0148, FLJ14564, MGC1224) (HRP)

Größe

£914.00

SKU:: 122831-HRP
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa637-736 from human ABLIM1 (NP_002304) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2C6
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Weitere Details:: May act as scaffold protein. May play a role in the development of the retina. Has been suggested to play a role in axon guidance. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: RYDSPINSASHIPSSKTASLPGYGRNGLHRPVSTDFAQYNSYGDVSGGVRDYQTLPDGHMPAMRMDRGVSMPNMLEPKIFPYEMLMVTNRGRNKILREVD Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.