122831-APC

ABLIM1 (Actin-binding LIM Protein 1, abLIM-1, Actin-binding LIM Protein Family Member 1, Actin-binding Double Zinc Finger Protein, LIMAB1, Limatin, ABLIM, KIAA0059, DKFZp781D0148, FLJ14564, MGC1224) (APC)

Größe

£927.00

SKU:: 122831-APC
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa637-736 from human ABLIM1 (NP_002304) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2C6
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Weitere Details:: May act as scaffold protein. May play a role in the development of the retina. Has been suggested to play a role in axon guidance. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: RYDSPINSASHIPSSKTASLPGYGRNGLHRPVSTDFAQYNSYGDVSGGVRDYQTLPDGHMPAMRMDRGVSMPNMLEPKIFPYEMLMVTNRGRNKILREVD Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.