ABCC6 (Multidrug Resistance-associated Protein 6, ATP-binding Cassette Sub-family C Member 6, Anthracycline Resistance-associated Protein, Multi-specific Organic Anion Transporter E, MOAT-E, ARA, MRP6)

Größe

£685.00

SKU:: 122808
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa831-930 from human ABCC6 (NP_001162) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1E6
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: May participate directly in the active transport of drugs into subcellular organelles or influence drug distribution indirectly. Transports glutathione conjugates as leukotriene-c4 (LTC4) and N-ethylmaleimide S-glutathione (NEM-GS). Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: IAEMGSYQELLQRKGALVCLLDQARQPGDRGEGETEPGTSTKDPRGTSAGRRPELRRERSIKSVPEKDRTTSEAQTEVPLDDPDRAGWPAGKDSIQYGRV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.