AATK (Serine/Threonine-protein Kinase LMTK1, Lemur Tyrosine Kinase 1, Apoptosis-associated Tyrosine Kinase, AATYK, Brain Apoptosis-associated Tyrosine Kinase, CDK5-binding Protein, p35-binding Protein, p35BP, AATYK, KIAA0641, LMR1, LMTK1)

Größe

£685.00

SKU:: 122789
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa161-260 from human AATK (AAH47378) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 5B8
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Apoptosis-associated tyrosine-protein kinase (ATTK) interacts with CDK5 and may be involved in neuronal differentiation. Applications: Suitable for use in ELISA, Immunohistochemistry and Western Blot. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: SPEFVLKEAQEGCEPQAFAELASEGEGPGPETRLSTSLSGLNEKNPYRDSAYFSDLEAEAEATSGPEKKCGGDRAPGPELGLRSTGQPSEQVCLRPGVSG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.