A4GALT (A14GALT, A4GALT1, Lactosylceramide 4-alpha-galactosyltransferase, Alpha-1,4-N-acetylglucosaminyltransferase, Alpha-1,4-galactosyltransferase, Alpha4Gal-T1, CD77 Synthase, Globotriaosylceramide Synthase, P1/Pk Synthase, UDP-galactose:beta-D-galactosyl-beta1-R 4-alpha-D-galactosyltransferase)

Größe

£685.00

SKU:: 122772
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa254-354 from human A4GALT (NP_059132) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3E12
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: The protein encoded by this gene catalyzes the transfer of galactose to lactosylceramide to form globotriaosylceramide, which has been identified as the P(k) antigen of the P blood group system. The encoded protein, which is a type II membrane protein found in the Golgi, is also required for the synthesis of the bacterial verotoxins receptor. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LTRVFKKWCSIRSLAESRACRGVTTLPPEAFYPIPWQDWKKYFEDINPEELPRLLSATYAVHVWNKKSQGTRFEATSRALLAQLHARYCPTTHEAMKMYL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.