122770
A2M (Alpha-2-macroglobulin, Alpha-2-M, CPAMD5, C3 and PZP-like alpha-2-macroglobulin Domain-containing Protein 5, FWP007)
Größe
£685.00
- SKU:
- 122770
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa641-730 from human A2M (NP_000005) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2B5
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- a2-Macroglobulin (a2M), is a 720kD homotetrameric glycoprotein composed of four identical 180kD subunit. a2M shares with other a-macroglobulins, like the complement components C3 and C4 and the pregnancy zone protein PZP, an extraordinary binding capacity for a variety of ligands. This allows the a-macroglobulins to serve as humoral defense barriers against foreign peptides in the plasma. a2M interacts and captures virtually any proteinase, often referred to as a panprotease inhibitor. In the brain of Alzheimer's disease (AD) patients, a2M also has been localized to diffuse amyloid plaques, supporting an important role for a2M in AD etiopathology. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: DCINRHNVYINGITYTPVSSTNEKDMYSFLEDMGLKAFTNSKIRKPKMCPQLQQYEMHGPEGLRVGFYESDVMGRGHARLVHVEEPHTET Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice