Pulmonary Surfactant-Associated Protein A2, Recombinant, Human, aa141-248, hFc1-Tag (SFTPA2)

Größe

£550.00

SKU:: 059472
Molekulargewicht:: 41
Reinheit:: ≥85% (SDS-PAGE).
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Format:: Supplied as a lyophilized powder from PBS, pH 7.4, 50% glycerol. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Weitere Details:: Pulmonary surfactant-associated protein A2 seems to play a crucial role in maintaining surfactant balance and supporting immune defense in the lungs. It's considered a key component of the pulmonary surfactant system, helping to reduce surface tension in the alveoli while participating in innate immune responses. Understanding this protein may prove vital for respiratory physiology research and disease studies. This recombinant SFTPA2 fragment is suitable for use as an immunogen to generate antibodies. The mammalian expression system may promote correct disulfide bonding within the CRD. Antibodies generated will be against this truncated, Fc-tagged fragment. Their ability to recognize the complex, oligomeric structure of full-length, native SFTPA2 in lung surfactant is very low and must be rigorously validated. The protein is most reliable for developing antibodies that detect denatured SFTPA2 (e.g., in Western blots) or the recombinant human SFTPA2 protein itself. Can be used in ELISA, however, it is critically important to understand its severe limitation: it is not suitable for measuring SFTPA2 levels in biological samples. An ELISA built with this recombinant SFTPA2 protein would only detect the fragment or antibodies against it. It would not accurately quantify the native, oligomeric full-length SFTPA2 present in bronchoalveolar lavage fluid, as the epitopes are completely different. Its use should be restricted to detecting antibodies against the immunogen. Partial recombinant protein corresponding aa141-248 from human SFTPA2, fused to fused to hFc1-Tag at C-terminal, expressed in Mammalian cell. Swiss/Uniprot: Q8IWL1 Molecular Weight: ~41kD Amino Acid Sequence: SNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Versandbedingungen:: Blue Ice