052473
TLR10 (Toll Like Receptor 10, CD290)
Größe
£709.00
- SKU:
- 052473
- Reinheit:
- Purified by affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Goat
- Immunogen:
- Synthetic peptide corresponding to aa81-111, C-HNRIQQLDLKTFEFNKELRYLDLSNNRLKSV, of the N-terminal domain of human TLR10.
- Format:
- Supplied as a liquid in PBS, pH 7.2, 1mg/ml BSA, 0.09% sodium azide.
- Weitere Details:
- Applications: Suitable for use in Western Blot and Immunohistochemistry. Other applications have not been tested. Recommended Dilution: Western Blot: 1:500 Immunohistochemistry (paraffin): 1:125 Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice