NM-MUB0903P
Mouse anti Integrin alpha 3B + alpha 6B
Eine Lieferung in diese Region ist nicht möglich.
- SKU:
- NM-MUB0903P
- Anwendung:
- WB, IHC-Fr, ICC
- Quelle:
- PB36 is a Mouse monoclonal IgG1, K Kappa antibody derived by fusion of SP2/0 Mouse myeloma cells with spleen cells from a BALB/c Mouse immunized with a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin A Alpha3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to keyhole limpet hemocyanin.
- Hersteller:
- Exalpha / Nordic Mubio
- Host:
- Mouse
- Reaktivitäten:
- Human
- Formulierung:
- Each vial contains 100 ul 1 mg/ml purified monoclonal antibody in PBS containing 0.09% sodium azide.
- Klonalität:
- Monoclonal
- Klon:
- PB36
- Isotyp:
- IgG1
- Format:
- Each vial contains 100 ul 1 mg/ml purified monoclonal antibody in PBS containing 0.09% sodium azide.
- Versandbedingungen:
- Ambient