CSB-EP842721HU
Recombinant Human V-set and transmembrane domain-containing protein 2-like protein (VSTM2L)
Größe
£251.00
- SKU:
- CSB-EP842721HU
- Zusätzliche Namen:
- C20orf102; dJ1118M15.2; Uncharacterized protein C20orf102 precursor; V set and transmembrane domain containing 2 like; V set and transmembrane domain containing protein 2 like protein; V-set and transmembrane domain-containing protein 2-like protein; VSTM 2L; Vstm2l; VTM2L_HUMAN|Recombinant Human VSTM2L protein
- Reinheit:
- >90%
- Hersteller:
- Cusabio
- Buffer:
- tris/pbs-based buffer
- Sequenz:
- TRPAGHAPWDNHVSGHALFTETPHDMTARTGEDVEMACSFRGSGSPSYSLEIQWWYVRSHRDWTDKQAWASNQLKASQQEDAGKEATKISVVKVVGSNISHKLRLSRVKPTDEGTYECRVIDFSDGKARHHKVKAYLRVQPGENSVLHLPEAPPAAPAPPPPKPGKELRKRSVDQEACSL
- Versandbedingungen:
- Blue Ice