ARG59756
anti-HSD3B2 antibody
Größe
£429.00
- SKU:
- ARG59756
- Zusätzliche Namen:
- hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2
- Anwendung:
- WB, IHC-P
- Konzentration:
- Batch dependent: 0.5 - 1
- Molekulargewicht:
- 42 kDa
- Aufreinigung:
- Affinity purified.
- Lagerbedingungen:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Hersteller:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reaktivitäten:
- Bovine, Canine, Human, Mouse, Rat, Caprine, Equine, Guinea Pig, Ovine
- Buffer:
- PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
- Immunogen:
- Synthetic peptide around the N-terminal region of Human HSD3B2. (within the following region: GWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQN)
- Synonyme:
- 3-beta-HSD adrenal and gonadal type; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type II; HSDB; EC 1.1.1.145; HSD3B; EC 5.3.3.1; 3-beta-HSD II; 5; Progesterone reductase; SDR11E2; Delta-5-3-ketosteroid isomerase; 3-beta-hydroxy-5-ene steroid dehydrogenase; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2
- Gendetails:
- 3284
- Versandbedingungen:
- Blue Ice