anti-HSPA2 antibody [4A4]

Größe

£408.00

SKU:: ARG59688
Zusätzliche Namen:: heat shock 70kDa protein 2
Anwendung:: Flow Cytometry, WB, IHC-P, IF, ICC
Konzentration:: 0.5
Molekulargewicht:: 70 kDa
Aufreinigung:: Affinity purification with immunogen.
Lagerbedingungen:: For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Hersteller:: Arigo Biolaboratories
Host:: Mouse
Reaktivitäten:: Human, Mouse, Rat
Buffer:: 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 4% Trehalose.
Immunogen:: Synthetic peptide corresponding to aa. 564-598 of Human HSPA2. (KISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHK)
Klon:: 4A4
Synonyme:: Heat shock 70 kDa protein 2; Heat shock-related 70 kDa protein 2; HSP70-2; HSP70-3
Gendetails:: 3306