ARG59549
anti-SFTPA1 + SFTPA2 antibody
Größe
£408.00
- SKU:
- ARG59549
- Zusätzliche Namen:
- surfactant protein A1; surfactant protein A2
- Anwendung:
- IHC-P, IHC-Fr
- Konzentration:
- 0.5
- Molekulargewicht:
- SFTPA1 and SFTPA2: 26 kDa
- Aufreinigung:
- Affinity purification with immunogen.
- Lagerbedingungen:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Hersteller:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Buffer:
- 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA.
- Immunogen:
- Synthetic peptide corresponding to aa. 206-237 of Human SFTPA1/2. (VNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRN)
- Synonyme:
- SFTPA1B; SP-A; COLEC4; Pulmonary surfactant-associated protein A1; PSAP; PSPA; 35 kDa pulmonary surfactant-associated protein; SFTP1; PSP-A; SPA; SPA1; Alveolar proteinosis protein; SP-A1; Collectin-4; PSAP; PSPA; SP-A; SPA2; PSP-A; SFTP1; SP-2A; SPAII; COLEC5; SFTPA2B
- Gendetails:
- 653509; 729238
- Versandbedingungen:
- Blue Ice