ARG59538
anti-KCNQ1 antibody
Größe
£408.00
- SKU:
- ARG59538
- Zusätzliche Namen:
- potassium channel, voltage gated KQT-like subfamily Q, member 1
- Anwendung:
- WB
- Konzentration:
- 0.5
- Molekulargewicht:
- 75 kDa
- Aufreinigung:
- Affinity purification with immunogen.
- Lagerbedingungen:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Hersteller:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reaktivitäten:
- Human, Rat
- Buffer:
- 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA.
- Immunogen:
- Synthetic peptide corresponding to aa. 356-397 of Human KCNQ1. (QQKQRQKHFNRQIPAAASLIQTAWRCYAAENPDSSTWKIYIR)
- Synonyme:
- Voltage-gated potassium channel subunit Kv7.1; KQT-like 1; JLNS1; LQT; KVLQT1; Kv1.9; KCNA9; IKs producing slow voltage-gated potassium channel subunit alpha KvLQT1; SQT2; RWS; LQT1; WRS; KCNA8; ATFB3; Potassium voltage-gated channel subfamily KQT member 1; Kv7.1; ATFB1
- Gendetails:
- 3784
- Versandbedingungen:
- Blue Ice