ARG59440
anti-SLC7A3 / CAT3 antibody
Größe
£408.00
- SKU:
- ARG59440
- Zusätzliche Namen:
- solute carrier family 7 (cationic amino acid transporter, y+ system), member 3
- Anwendung:
- WB
- Konzentration:
- 0.5
- Molekulargewicht:
- 67 kDa
- Aufreinigung:
- Affinity purification with immunogen.
- Lagerbedingungen:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Hersteller:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Buffer:
- 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA.
- Immunogen:
- Synthetic peptide corresponding to aa. 1-30 of Human SLC7A3 / CAT3. (MPWQAFRRFGQKLVRRRTLESGMAETRLAR)
- Synonyme:
- ATRC3; Cationic amino acid transporter y+; Solute carrier family 7 member 3; CAT-3; Cationic amino acid transporter 3; CAT3
- Gendetails:
- 84889
- Versandbedingungen:
- Blue Ice