ARG59326
anti-PIAS4 antibody
Größe
£408.00
- SKU:
- ARG59326
- Zusätzliche Namen:
- protein inhibitor of activated STAT, 4
- Anwendung:
- WB
- Konzentration:
- 0.5
- Molekulargewicht:
- 57 kDa
- Aufreinigung:
- Affinity purification with immunogen.
- Lagerbedingungen:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Hersteller:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reaktivitäten:
- Bovine, Canine, Human, Mouse, Rat, Equine
- Buffer:
- 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA.
- Immunogen:
- Synthetic peptide corresponding to aa. 130-174 of Human PIAS4. (EVRLVKLPFFNMLDELLKPTELVPQNNEKLQESPCIFALTPRQVE)
- Synonyme:
- PIASy; Piasg; EC 6.3.2.-; Protein inhibitor of activated STAT protein 4; Protein inhibitor of activated STAT protein gamma; E3 SUMO-protein ligase PIAS4; PIAS-gamma; PIASY; ZMIZ6
- Gendetails:
- 51588
- Versandbedingungen:
- Blue Ice