ARG59226
anti-UBA3 antibody
Größe
£408.00
- SKU:
- ARG59226
- Zusätzliche Namen:
- ubiquitin-like modifier activating enzyme 3
- Anwendung:
- Flow Cytometry, WB, IHC-P, IF, ICC
- Konzentration:
- 0.5
- Molekulargewicht:
- 52 kDa
- Aufreinigung:
- Affinity purification with immunogen.
- Lagerbedingungen:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Hersteller:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reaktivitäten:
- Bovine, Canine, Human, Mouse, Rabbit, Rat, Equine
- Buffer:
- 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA.
- Immunogen:
- Synthetic peptide corresponding to aa. 409-448 of Human UBA3. (KNRTLYLQSVTSIEERTRPNLSKTLKELGLVDGQELAVAD)
- Synonyme:
- EC 6.3.2.-; Ubiquitin-activating enzyme E1C; UBE1C; Ubiquitin-like modifier-activating enzyme 3; Ubiquitin-activating enzyme 3; NAE2; hUBA3; NEDD8-activating enzyme E1 catalytic subunit; NEDD8-activating enzyme E1C
- Gendetails:
- 9039
- Versandbedingungen:
- Blue Ice