ARG59225
anti-SMC3 antibody
Größe
£408.00
- SKU:
- ARG59225
- Zusätzliche Namen:
- structural maintenance of chromosomes 3
- Anwendung:
- WB
- Konzentration:
- 0.5
- Molekulargewicht:
- 142 kDa
- Aufreinigung:
- Affinity purification with immunogen.
- Lagerbedingungen:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Hersteller:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reaktivitäten:
- Bovine, Human, Mouse, Rabbit, Rat, Equine
- Buffer:
- 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA.
- Immunogen:
- Synthetic peptide corresponding to aa. 1178-1216 of Human SMC3. (ELLESADKFYGVKFRNKVSHIDVITAEMAKDFVEDDTTH)
- Synonyme:
- CDLS3; CSPG6; SMC3L1; SMC-3; Chromosome-associated polypeptide; BMH; Basement membrane-associated chondroitin proteoglycan; Structural maintenance of chromosomes protein 3; Bamacan; hCAP; Chondroitin sulfate proteoglycan 6; SMC protein 3; HCAP; BAM
- Gendetails:
- 9126
- Versandbedingungen:
- Blue Ice