ARG59223
anti-ARID1A antibody
Größe
£408.00
- SKU:
- ARG59223
- Zusätzliche Namen:
- AT rich interactive domain 1A (SWI-like)
- Anwendung:
- WB
- Konzentration:
- 0.5
- Molekulargewicht:
- 242 kDa
- Aufreinigung:
- Affinity purification with immunogen.
- Lagerbedingungen:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Hersteller:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reaktivitäten:
- Hamster, Human
- Buffer:
- 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA.
- Immunogen:
- Synthetic peptide corresponding to aa. 1021-1053 of Human ARID1A. (KMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYR).
- Synonyme:
- MRD14; BRG1-associated factor 250a; BAF250a; C1orf4; OSA1; SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatin subfamily F member 1; hELD; SWI-like protein; BAF250; P270; BAF250A; ELD; SMARCF1; B120; BRG1-associated factor 250; ARID domain-containing protein 1A; SWI/SNF complex protein p270; AT-rich interactive domain-containing protein 1A; hOSA1; Osa homolog 1; BM029
- Gendetails:
- 8289
- Versandbedingungen:
- Blue Ice