ARG59212
anti-CCDC6 antibody
Größe
£408.00
- SKU:
- ARG59212
- Zusätzliche Namen:
- coiled-coil domain containing 6
- Anwendung:
- Flow Cytometry, WB, IF, ICC
- Konzentration:
- 0.5
- Molekulargewicht:
- 53 kDa
- Aufreinigung:
- Affinity purification with immunogen.
- Lagerbedingungen:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Hersteller:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reaktivitäten:
- Bovine, Canine, Fish, Hamster, Human, Rabbit, Rat, Equine
- Buffer:
- 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA.
- Immunogen:
- Synthetic peptide corresponding to aa. 156-198 of Human CCDC6. (KAELEQHLEQEQEFQVNKLMKKIKKLENDTISKQLTLEQLRRE)
- Synonyme:
- TPC; PTC; D10S170; H4; Papillary thyroid carcinoma-encoded protein; Coiled-coil domain-containing protein 6; Protein H4; TST1
- Gendetails:
- 8030
- Versandbedingungen:
- Blue Ice