ARG59144
anti-TAP1 antibody
Größe
£429.00
- SKU:
- ARG59144
- Zusätzliche Namen:
- transporter 1, ATP-binding cassette, sub-family B (MDR/TAP)
- Anwendung:
- WB, IHC-P
- Konzentration:
- Batch dependent: 0.5 - 1
- Molekulargewicht:
- 87 kDa
- Aufreinigung:
- Affinity purified.
- Lagerbedingungen:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Hersteller:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reaktivitäten:
- Bovine, Fish, Human, Mouse, Rabbit, Rat, Equine, Guinea Pig
- Buffer:
- PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
- Immunogen:
- Synthetic peptide around the middle region of Human TAP1. (within the following region: LVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGL)
- Synonyme:
- Really interesting new gene 4 protein; ABC17; TAP1*0102N; ATP-binding cassette sub-family B member 2; TAP1N; RING4; Antigen peptide transporter 1; ABCB2; APT1; Peptide transporter involved in antigen processing 1; PSF-1; D6S114E; PSF1; Peptide transporter PSF1; Peptide transporter TAP1; Peptide supply factor 1
- Gendetails:
- 6890
- Versandbedingungen:
- Blue Ice