ARG59037
anti-MGST1 antibody
Größe
£408.00
- SKU:
- ARG59037
- Zusätzliche Namen:
- microsomal glutathione S-transferase 1
- Anwendung:
- WB
- Konzentration:
- 0.5
- Molekulargewicht:
- 18 kDa
- Aufreinigung:
- Affinity purification with immunogen.
- Lagerbedingungen:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Hersteller:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Buffer:
- 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA.
- Immunogen:
- Synthetic peptide corresponding to aa. 42-75 of Human MGST1 (KVFANPEDCVAFGKGENAKKYLRTDDRVERVRRA).
- Synonyme:
- Microsomal GST-1; EC 2.5.1.18; Microsomal glutathione S-transferase 1; MGST; MGST-I; Microsomal GST-I; GST12
- Gendetails:
- 4257
- Versandbedingungen:
- Blue Ice