ARG59029
anti-ARHGEF1 antibody
Größe
£408.00
- SKU:
- ARG59029
- Zusätzliche Namen:
- Rho guanine nucleotide exchange factor (GEF) 1
- Anwendung:
- Flow Cytometry, WB, IHC-P, IF, ICC
- Konzentration:
- 0.5
- Molekulargewicht:
- 102 kDa
- Aufreinigung:
- Affinity purification with immunogen.
- Lagerbedingungen:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Hersteller:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reaktivitäten:
- Hamster, Human, Mouse, Rat
- Buffer:
- 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA.
- Immunogen:
- Synthetic peptide corresponding to aa. 41-71 of Human ARHGEF1 (EQNSQFQSLEQVKRRPAHLMALLQHVALQFE).
- Synonyme:
- p115RhoGEF; LSC; SUB1.5; Sub1.5; LBCL2; Rho guanine nucleotide exchange factor 1; P115-RHOGEF; 115 kDa guanine nucleotide exchange factor; p115-RhoGEF; GEF1
- Gendetails:
- 9138
- Versandbedingungen:
- Blue Ice