ARG59020
anti-RAB6A antibody
Größe
£408.00
- SKU:
- ARG59020
- Zusätzliche Namen:
- RAB6A, member RAS oncogene family
- Anwendung:
- WB, IHC-P
- Konzentration:
- 0.5
- Molekulargewicht:
- 24 kDa
- Aufreinigung:
- Affinity purification with immunogen.
- Lagerbedingungen:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Hersteller:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Buffer:
- 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 4% Trehalose.
- Immunogen:
- Synthetic peptide corresponding to a sequence of Human RAB6A (RRVAAALPGMESTQDRSREDMIDIKLEKPQEQPVSE).
- Synonyme:
- Ras-related protein Rab-6A; Rab-6; RAB6
- Gendetails:
- 5870
- Versandbedingungen:
- Blue Ice