ARG58936
anti-GNGT2 antibody
Größe
£429.00
- SKU:
- ARG58936
- Zusätzliche Namen:
- guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 2
- Anwendung:
- WB
- Konzentration:
- Batch dependent: 0.5 - 1
- Molekulargewicht:
- 8 kDa
- Aufreinigung:
- Affinity purified.
- Lagerbedingungen:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Hersteller:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reaktivitäten:
- Bovine, Canine, Human, Mouse, Rabbit, Rat, Equine, Guinea Pig, Ovine
- Buffer:
- PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
- Immunogen:
- Synthetic peptide around the middle region of Human GNGT2. (within the following region: KEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS)
- Synonyme:
- GNG8; GNG9; GNGT8; G-GAMMA-8; G-GAMMA-C; Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2; G gamma-C; G-gamma-8; G-gamma-9; Guanine nucleotide binding protein gamma transducing activity polypeptide 2
- Gendetails:
- 2793
- Versandbedingungen:
- Blue Ice