ARG58833
anti-LOXL2 antibody
Größe
£408.00
- SKU:
- ARG58833
- Zusätzliche Namen:
- lysyl oxidase-like 2
- Anwendung:
- WB
- Konzentration:
- 0.5
- Molekulargewicht:
- 87 kDa
- Aufreinigung:
- Affinity purification with immunogen.
- Lagerbedingungen:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Hersteller:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reaktivitäten:
- Bovine, Human, Mouse, Rat
- Buffer:
- 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA.
- Immunogen:
- Synthetic peptide corresponding to aa. 739-770 of Human LOXL2 (HRIWMYNCHIGGSFSEETEKKFEHFSGLLNNQ).
- Synonyme:
- Lysyl oxidase-related protein 2; Lysyl oxidase-related protein WS9-14; LOR2; Lysyl oxidase-like protein 2; Lysyl oxidase homolog 2; EC 1.4.3.13; WS9-14
- Gendetails:
- 4017
- Versandbedingungen:
- Blue Ice