ARG58782
anti-GFI1 antibody
Größe
£408.00
- SKU:
- ARG58782
- Zusätzliche Namen:
- growth factor independent 1 transcription repressor
- Anwendung:
- IHC-P
- Konzentration:
- 0.5
- Molekulargewicht:
- 45 kDa
- Lagerbedingungen:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Hersteller:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Buffer:
- 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 4% Trehalose.
- Immunogen:
- Synthetic peptide corresponding to a sequence of Human GFI1 (NLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRETQH).
- Synonyme:
- GFI-1; Growth factor independent protein 1; ZNF163; GFI1A; Zinc finger protein Gfi-1; SCN2; Zinc finger protein 163
- Gendetails:
- 2672
- Versandbedingungen:
- Blue Ice