ARG58780
anti-GSTM1 antibody
Größe
£408.00
- SKU:
- ARG58780
- Zusätzliche Namen:
- glutathione S-transferase mu 1
- Anwendung:
- Flow Cytometry, WB
- Konzentration:
- 0.5
- Molekulargewicht:
- 26 kDa
- Aufreinigung:
- Affinity purification with immunogen.
- Lagerbedingungen:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Hersteller:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Buffer:
- 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 4% Trehalose.
- Immunogen:
- Synthetic peptide corresponding to a sequence of Human GSTM1 (EEEKIRVDILENQTMDNHMQLGMICYNPEFEKLK).
- Synonyme:
- GST HB subunit 4; MU-1; GST class-mu 1; GST1; Glutathione S-transferase Mu 1; GSTM1-1; GSTM1a-1a; MU; GTH4; EC 2.5.1.18; GSTM1b-1b; H-B; GTM1
- Gendetails:
- 2944
- Versandbedingungen:
- Blue Ice