ARG58552
anti-DR1 antibody
Größe
£429.00
- SKU:
- ARG58552
- Zusätzliche Namen:
- down-regulator of transcription 1
- Anwendung:
- WB
- Konzentration:
- Batch dependent: 0.5 - 1
- Molekulargewicht:
- 19 kDa
- Aufreinigung:
- Affinity purified.
- Lagerbedingungen:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Hersteller:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reaktivitäten:
- Bovine, Canine, Fish, Human, Mouse, Porcine, Rabbit, Rat, Equine, Guinea Pig
- Buffer:
- PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
- Immunogen:
- Synthetic peptide of Human DR1. (within the following sequence: KKTISPEHVIQALESLGFGSYISEVKEVLQECKTVALKRRKASSRLENLG)
- Synonyme:
- Dr1l; NC2; TATA-binding protein-associated phosphoprotein; Protein Dr1; NC2-beta; 1700121L09Rik; NC2beta; Down-regulator of transcription 1; Negative cofactor 2-beta; NC2B; NCB2
- Gendetails:
- 1810
- Versandbedingungen:
- Blue Ice